Basic Information | |
---|---|
Taxon OID | 3300011426 Open in IMG/M |
Scaffold ID | Ga0151147_1022551 Open in IMG/M |
Source Dataset Name | Fecal eukaryotic communites from dung pellets of Tule Elk in California, USA - Elk Dung E36 Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 590 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Elk Feces → Fecal Eukaryotic Communites From Dung Pellets Of Tule Elk In California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Point Reyes National Seashore, California | |||||||
Coordinates | Lat. (o) | 38.04 | Long. (o) | -122.5 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F068418 | Metagenome / Metatranscriptome | 124 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0151147_10225512 | F068418 | N/A | MDSWVWDQVGLEFSDIDVEGTIESQRSSQRGDNLSDKSVQVGISGSFDIELSSADIVDSFVIKHNSDISMFQKGVSGQ |
⦗Top⦘ |