Scaffold Ga0137441_1064714

Overview

Basic Information

• Taxon OID: 3300011425
• Scaffold ID: Ga0137441_1064714
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 847
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.9778
  • Long. (^o): -107.0027
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071914	Metagenome	121	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0137441_10647143	F071914	GGCGG	MSPDAKLEGKIVRTLARFLVNEQALIRRWRVVGKASIFLGSLLWALAILAYAQNACAPWVFAALSGVGGLCLGLGLWFSTFVTQWPVVRQFIDAEKVRQRASEIDDQGPK*