Scaffold Ga0137424_1021438

Overview

Basic Information

• Taxon OID: 3300011412
• Scaffold ID: Ga0137424_1021438
• Source Dataset Name: Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 993
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location

• Location Name: USA: East River, Colorado
• Coordinates
  • Lat. (^o): 38.8896
  • Long. (^o): -106.9081
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092756	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137424_10214382	F092756	N/A	VVVTGILALGCEFAYQVNLIVGLFAILAFILAISALLLLPSALVGRIAARGGARRDGDIAMAIFASYCIGQFMPLFY*