Basic Information | |
---|---|
Taxon OID | 3300011405 Open in IMG/M |
Scaffold ID | Ga0137340_1035202 Open in IMG/M |
Source Dataset Name | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 939 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: East River, Colorado | |||||||
Coordinates | Lat. (o) | 38.9227 | Long. (o) | -106.9523 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F026496 | Metagenome / Metatranscriptome | 197 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137340_10352022 | F026496 | N/A | MNEPPETREELVQHLEKLTGRTLRTREDIQAYVREVSARKATDQPSVRRWLNAKKITLIALLALSVLQYYILDVLLQIASMRAPTYFVPASTPKLKSMVEMLA* |
⦗Top⦘ |