Scaffold Ga0153700_10666

Overview

Basic Information

• Taxon OID: 3300011339
• Scaffold ID: Ga0153700_10666
• Source Dataset Name: Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Finished

Scaffold Components

• Scaffold Length (bps): 16532
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (77.27%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Lotic Viral Community From Han River, Hwacheon, Gangwon-Do, South Korea

Source Dataset Sampling Location

• Location Name: Seoul, South Korea
• Coordinates
  • Lat. (^o): 37.5254611
  • Long. (^o): 127.0168945

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014133	Metagenome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153700_106661	F014133	N/A	EWLINHWVMPTPAELIAEELIHAQRTKLRHQSAMEYHTAIVAYNVARIKRLEQLTAKQEVVE*