NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151613_1009578

Scaffold Ga0151613_1009578


Overview

Basic Information
Taxon OID3300011265 Open in IMG/M
Scaffold IDGa0151613_1009578 Open in IMG/M
Source Dataset NameAcid mine drainage microbial communities from Malanjkhand copper mine, India - M8 K-mer 55
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterXcelris labs Ltd
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2010
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location
Location NameMalanjkhand, India
CoordinatesLat. (o)21.9985Long. (o)80.697983Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F053270Metagenome / Metatranscriptome141Y

Sequences

Protein IDFamilyRBSSequence
Ga0151613_10095781F053270N/AGAAVAGRKIFLRFAQASDVERLTREGVITAPPPAKETWNQRIVRWLSEQRAGRRAVLVAEDSTGLLGILHLVFELPVGFKDPEAANGFDIAMIEGLHMRAGVPPEVGNEMIEEIQRIATKRNVTTLTFCIPMNQPRAIRQVKEWGFEEFRIMAEPSKMLAFFRKTV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.