Scaffold Ga0151623_1136316

Overview

Basic Information

• Taxon OID: 3300011264
• Scaffold ID: Ga0151623_1136316
• Source Dataset Name: Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Xcelris labs Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 547
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas sediminicola (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location

• Location Name: Malanjkhand , India
• Coordinates
  • Lat. (^o): 22.023017
  • Long. (^o): 80.732183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104734	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151623_11363161	F104734	N/A	MAPKRLPATLHVLYLFRMRRFGMTDLRERALAAVDEAADQASDGPVRRTLALRFTLAFLANFADERWPFDNFWQSIASSNDRGRWQNANAARNAIRRSVRVERNDCSGH*