Scaffold Ga0151623_1003651

Overview

Basic Information

• Taxon OID: 3300011264
• Scaffold ID: Ga0151623_1003651
• Source Dataset Name: Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer 63
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Xcelris labs Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1081
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → unclassified Desulfobacca → Desulfobacca sp. RBG_16_60_12 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment → Acid Mine Drainage Microbial Communities From Malanjkhand Copper Mine, India

Source Dataset Sampling Location

• Location Name: Malanjkhand , India
• Coordinates
  • Lat. (^o): 22.023017
  • Long. (^o): 80.732183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021446	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151623_10036511	F021446	AGGAGG	MKTLCIALMAAFMLVLAATSTGQAQLSEDLVYNDPSPGGKYVYRGCNLAEVIFIRGDKLSEINELTLIIETQGSSTPLRLTLPILAKRQEGNKSILDYQWPLDGDKYEATIIGGTLINRKTRGWLAGEREEVYTRE*