Scaffold Ga0151668_1400743

Overview

Basic Information

• Taxon OID: 3300011262
• Scaffold ID: Ga0151668_1400743
• Source Dataset Name: Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Toyama Prefectural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 516
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → unclassified Desulfobulbaceae → Desulfobulbaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location

• Location Name: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 37.31041
  • Long. (^o): 137.23108
  • Depth (m): 11

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099324	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151668_14007431	F099324	N/A	MLGSALVLSGCATTDKGPNVEGEEYNYRSGYPPRGGFDSTTQDKAQVTGACWAEANKLVKGDFRADDRARLVYFSHGMLKNGYDSDGNFVGIPPE*