Scaffold Ga0151677_1019728

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151677_1019728

Scaffold Ga0151677_1019728

Overview

Basic Information
Taxon OID	3300011258 Open in IMG/M
Scaffold ID	Ga0151677_1019728 Open in IMG/M
Source Dataset Name	Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Toyama Prefectural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6680
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (68.75%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location Name	Japan Sea near Toyama Prefecture, JAPAN
Coordinates	Lat. (^o)	36.97018	Long. (^o)	137.37008	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080643	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0151677_10197289	F080643	GGAG	MKKQTIDITPSWKTSGEILIMALQNPKLSKEGFDEGMAQIREMASKLDTACKELNKLAKEKGQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.