Scaffold Ga0151673_134594

Overview

Basic Information

• Taxon OID: 3300011245
• Scaffold ID: Ga0151673_134594
• Source Dataset Name: Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Toyama Prefectural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 563
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location

• Location Name: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 37.36555
  • Long. (^o): 137.72861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022424	Metagenome	214	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151673_1345941	F022424	AGGA	MKNEMNLMHQTVDVLIKSATHQEDYRKELETLDDIAAVLNTLECNIDRKSPITGNALKVAKYKLGKK