Scaffold Ga0151673_109775

Overview

Basic Information

• Taxon OID: 3300011245
• Scaffold ID: Ga0151673_109775
• Source Dataset Name: Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Toyama Prefectural University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2308
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location

• Location Name: Japan Sea near Toyama Prefecture, JAPAN
• Coordinates
  • Lat. (^o): 37.36555
  • Long. (^o): 137.72861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016937	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151673_1097752	F016937	N/A	MKIYTAQVNQFGNVIVCGDDIPRNSYKIIFKGSYKDCLKLK*