Scaffold Ga0137483_100928

Overview

Basic Information

• Taxon OID: 3300011244
• Scaffold ID: Ga0137483_100928
• Source Dataset Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3606
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Midre Lovenbreen, Svalbard, Norway
• Coordinates
  • Lat. (^o): 78.97888889
  • Long. (^o): 12.33222222
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032127	Metagenome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137483_1009284	F032127	N/A	MNIDEALLCLNDRLGQEVTAWIEVIHEQPLLIATGILENWGRETTPEAVRENPQRFDLYGHYSLADARFDLSDAPVESVSDRPDGKGLTFRFAGGVRLIVTWLPMPEEGMV*