Scaffold Ga0137476_102978

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137476_102978

Scaffold Ga0137476_102978

Overview

Basic Information
Taxon OID	3300011241 Open in IMG/M
Scaffold ID	Ga0137476_102978 Open in IMG/M
Source Dataset Name	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 11 - S13.2.50.a - transect 2, age 50 years, surface depth).
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	985
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Midre Lovenbreen, Svalbard, Norway
Coordinates	Lat. (^o)	78.92166667	Long. (^o)	12.07666667	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005682	Metagenome / Metatranscriptome	393	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137476_1029781	F005682	AGGAG	MTYEYDFEMVKRAYAEMARRAREKDEVRRLPRNGLPQQPQRQDALERQRFPA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.