Scaffold Ga0137472_103710

Overview

Basic Information

• Taxon OID: 3300011198
• Scaffold ID: Ga0137472_103710
• Source Dataset Name: Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 7 - S13.1.40.a - transect 1, age 29 years, surface depth)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Bristol
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 785
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location

• Location Name: Norway: Midre Lovenbreen, Svalbard
• Coordinates
  • Lat. (^o): 79.1525
  • Long. (^o): 12.21555556
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013424	Metagenome / Metatranscriptome	271	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137472_1037102	F013424	AGGAGG	MAQGSGKAPKQITWIICLVLYVVALLAHFAVVKVGGDIAAWSWIIGFGLLLAAVQVKGL*