Scaffold Ga0137469_101533

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137469_101533

Scaffold Ga0137469_101533

Overview

Basic Information
Taxon OID	3300011195 Open in IMG/M
Scaffold ID	Ga0137469_101533 Open in IMG/M
Source Dataset Name	Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 4 - S13.1.30.a - transect 1, age 5 years, surface depth)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	561
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Norway: Midre Lovenbreen, Svalbard
Coordinates	Lat. (^o)	79.11833333	Long. (^o)	12.09361111	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069065	Metagenome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137469_1015331	F069065	AGGAG	MARVNGKAGFWGRVGSAFERSDIGSDSVDDADDADAVRPTTTRYAPIRQAVERRIKSFLRQDVVSHLEIGFNEVFLLHYIEIAADRQGNEELEQFLEEFPPDSRVHWVKKLLGPAVGQYVKVDQFLGLDKEFSAEELAETDPFEEKLNQAAQALYRVILHGRWESGGPAVDSP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.