Scaffold Ga0150983_11736223

Overview

Basic Information

• Taxon OID: 3300011120
• Scaffold ID: Ga0150983_11736223
• Source Dataset Name: Combined assembly of Microbial Forest Soil metaT
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 908
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location

• Location Name: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.532967
  • Long. (^o): -72.180244
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058060	Metagenome / Metatranscriptome	135	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0150983_117362231	F058060	N/A	CVASGLHRRELIEMRFAMSANKFVLQGVLLFVILNLSCGGIKDISQAISHDICGCLPLEPDAADYRHAAKHVPLPGGTPQEIGVATILAWPQDPILPIDQPRTDRELQLVHVAQAFLENASVNPGDCDVHLEISQIADKNAPRVVIETPVDGKYCSARANIQAQLKKHGFQLDVQHGGELQQPLAIDFLGLPFEDFEHGRGSPQVSTLWEIHPAIVTIM*