Scaffold Ga0114922_10255146

Overview

Basic Information

• Taxon OID: 3300011118
• Scaffold ID: Ga0114922_10255146
• Source Dataset Name: Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1470
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (80.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Aarhus Bay
• Coordinates
  • Lat. (^o): 56.103
  • Long. (^o): 10.458
  • Depth (m): 27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066141	Metagenome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114922_102551462	F066141	AGGAGG	MTRKQELLMMLERVNNAFNLELDLNNAPIYGGWQLTNKEGSHIIKHRVSIKEMLCFLDGMLKALEIRG*