Scaffold Ga0114922_10227703

Overview

Basic Information

• Taxon OID: 3300011118
• Scaffold ID: Ga0114922_10227703
• Source Dataset Name: Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1567
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Aarhus Bay
• Coordinates
  • Lat. (^o): 56.103
  • Long. (^o): 10.458
  • Depth (m): 27

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030249	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114922_102277033	F030249	GAGG	MTRNKYGLPLIFDYVNSIDQKRIKNLEYMKDNCTKDWKELWSKKLDQLRKNIHDRQRKTLN*