Scaffold Ga0138565_1005778

Overview

Basic Information

• Taxon OID: 3300011078
• Scaffold ID: Ga0138565_1005778
• Source Dataset Name: Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 575
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location

• Location Name: Germany: Weissenstadt
• Coordinates
  • Lat. (^o): 50.13
  • Long. (^o): 11.88

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052212	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138565_10057782	F052212	N/A	ASDITEEYNKELNPGPTQRLYDTITDHSRNGVVAKHAVDHAIKNTAIESAQPTINPGN*