Scaffold Ga0114934_10174627

Overview

Basic Information

• Taxon OID: 3300011013
• Scaffold ID: Ga0114934_10174627
• Source Dataset Name: Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1005
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: Kolumbo volcano, Aegean Sea
• Coordinates
  • Lat. (^o): 36.5275
  • Long. (^o): 25.4914
  • Depth (m): 482

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008153	Metagenome	338	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114934_101746271	F008153	N/A	HLATDVQTIILQEYKMAKDLITMNNVNIQPLMESLVELVKDKKATGELDDLINAKLPEKTSADWKLICGVLCNSVVEWVAVNKDEEVQSTDLLKHLQSDIGYILKRLGLS*