NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0150979_1090417

Scaffold Ga0150979_1090417


Overview

Basic Information
Taxon OID3300011012 Open in IMG/M
Scaffold IDGa0150979_1090417 Open in IMG/M
Source Dataset NameMarine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBerlin Center for Genomics in Biodiversity Research (BeGenDiv)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1163
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → Candidatus Falkowbacteria → Candidatus Falkowbacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)57.32Long. (o)20.05Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004838Metagenome / Metatranscriptome421Y
F041159Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0150979_10904171F041159N/AMSQVGKLGYVDSKLGAPTSGQQTTRILFNTIEVPGTTSSLSFFKNFQGLTDGQTNLT
Ga0150979_10904172F004838N/AMALSAQDKILYVANKLGLSTLGNMQGSTGAVYDVDTDLSGQIFSSASRHQNPGTTNVTENQFEVNEALLVETIGFFTKRTNGEARNFQAEYGSNAVIVFDLIIGNKRVMKDTPVFAAGSPYTFANSGVTSDGGPEAALSSYSPRHQTFLEGAGILIPPQVQWYVDYRIFNVVTGATIAATDETALGCYLFGTRVLLNFNTSI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.