Scaffold Ga0139556_1019233

Overview

Basic Information

• Taxon OID: 3300011011
• Scaffold ID: Ga0139556_1019233
• Source Dataset Name: Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 987
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 41.825
  • Long. (^o): -82.975
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061839	Metagenome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0139556_10192331	F061839	GAG	MAKEVKMVSTSEEVEQIENSALLACDFIYETLLPLLEEFENDNDDLDYIPGVATHGLFVALIQELADLGYTQKDLNKEIKTYMNTSIGEVVH