Scaffold Ga0139557_1009763

Overview

Basic Information

• Taxon OID: 3300011010
• Scaffold ID: Ga0139557_1009763
• Source Dataset Name: Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1895
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 41.825
  • Long. (^o): -82.975

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007405	Metagenome	351	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139557_10097634	F007405	AGG	MSIGFGNLKHSFTYDGAQVNVYHANTGEGLPKHEHTYSHATMCNAGSCLVSLDGRSYTINKDSQPLNLPAGEWHEIEALEDGTVFVNVFSEGKY*