Scaffold Ga0139299_1128919

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139299_1128919

Scaffold Ga0139299_1128919

Overview

Basic Information
Taxon OID	3300011007 Open in IMG/M
Scaffold ID	Ga0139299_1128919 Open in IMG/M
Source Dataset Name	Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Tsinghua University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1622
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice → Basal Ice Microbial Communities From Matanuska Glacier, Alaska, Usa - Matab

Source Dataset Sampling Location
Location Name	Matanuska glacier, Alaska, USA
Coordinates	Lat. (^o)	61.6558	Long. (^o)	147.5811	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050966	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139299_11289191	F050966	GAGG	MSGSRWQGMKTRYGDGTEALSEEMESNRSATPKSRRHRLTLPPDWWDSARF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.