Basic Information | |
---|---|
Taxon OID | 3300011007 Open in IMG/M |
Scaffold ID | Ga0139299_1125163 Open in IMG/M |
Source Dataset Name | Basal ice microbial communities from Matanuska glacier, Alaska, USA - MataB |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Tsinghua University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2635 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Ice → Glacier → Basal Ice → Basal Ice Microbial Communities From Matanuska Glacier, Alaska, Usa - Matab |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Matanuska glacier, Alaska, USA | |||||||
Coordinates | Lat. (o) | 61.6558 | Long. (o) | 147.5811 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036991 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0139299_11251632 | F036991 | GAG | MSGIVAQHLSGLRCYQEVTDETDGDTTGDPEDAI* |
⦗Top⦘ |