Scaffold Ga0139324_1029772

Overview

Basic Information

• Taxon OID: 3300010997
• Scaffold ID: Ga0139324_1029772
• Source Dataset Name: ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1115
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes

Source Dataset Sampling Location

• Location Name: Louisiana, Port Sulphur, Bay Sansbois east
• Coordinates
  • Lat. (^o): 29.45083
  • Long. (^o): -89.75005
  • Depth (m): 0 to .02

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076640	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139324_10297722	F076640	N/A	MDPNEFLFLILPLAALVTILVIVVFYLARKEDTMRHKEVETLNELMHTGTVDKENFSAALQGLVRNKLIDKTSFDRLGKLLEDSFNESEETCSQPEPA*