Basic Information | |
---|---|
Taxon OID | 3300010997 Open in IMG/M |
Scaffold ID | Ga0139324_1008219 Open in IMG/M |
Source Dataset Name | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Molecular Research LP (MR DNA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1748 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Louisiana, Port Sulphur, Bay Sansbois east | |||||||
Coordinates | Lat. (o) | 29.45083 | Long. (o) | -89.75005 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005089 | Metagenome / Metatranscriptome | 412 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0139324_10082192 | F005089 | N/A | MSTNELLSSIKLSEQLALEHYQQLNGVVDYRLPGVCHHYFAKYDLNGTRNGEICLTCKVAKTVKGQLRYTFQINGKRIAEKQIASEFNALGAFTH* |
⦗Top⦘ |