Scaffold Ga0138316_10797360

Overview

Basic Information

• Taxon OID: 3300010981
• Scaffold ID: Ga0138316_10797360
• Source Dataset Name: Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 629
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): 18.7998
  • Long. (^o): -20.70285

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018934	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138316_107973601	F018934	N/A	EEEQATLAAAGTLAPTMAPGGIAGTGIGLVQTATAPPPPPESFDAYSKKSEESNGIIAMMDLLIKDLDKEMTEAEVTEKDAQEDYEVFMKDSADKRAQDSKTLTDKEGALAALKSGLEDQKGSLASTTKELAATNQYIHTLHLECDWLIKYYDMRKEARANEIDALGKAKAVLSGADYSLIQTSARARKFLRH*