Scaffold Ga0137575_10019818

Overview

Basic Information

• Taxon OID: 3300010970
• Scaffold ID: Ga0137575_10019818
• Source Dataset Name: Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: FASTERIS
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1110
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila → Candidatus Planktophila versatilis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location

• Location Name: Jussy, Geneva, SWITZERLAND
• Coordinates
  • Lat. (^o): 46.25
  • Long. (^o): 6.28

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034573	Metagenome	174	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137575_100198182	F034573	AGGAG	MYRVSKSVHTSKEEKTAIAMGKLLSDFHLDLEKVGYYLAKATPYLIFRRSLEVLESAEFQLDIVEQDRLQYNHDRLF*