Scaffold Ga0139250_1015313

Overview

Basic Information

• Taxon OID: 3300010968
• Scaffold ID: Ga0139250_1015313
• Source Dataset Name: Microbial communities from the middle layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.mid
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Hellenic Centre for Marine Research (HCMR)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1460
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat → Inactive Hydrothermal Chimney Metagenome Study

Source Dataset Sampling Location

• Location Name: Kolumbo submarine Volcano, Hellenic Volcanic Arc, Aegean Sea, Greece
• Coordinates
  • Lat. (^o): 36.52
  • Long. (^o): 25.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035771	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139250_10153134	F035771	N/A	NVEKSHQRRSRPFAVLTYWKYAPRVKTAAALLDGLF*