Scaffold Ga0138308_195821

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138308_195821

Scaffold Ga0138308_195821

Overview

Basic Information
Taxon OID	3300010965 Open in IMG/M
Scaffold ID	Ga0138308_195821 Open in IMG/M
Source Dataset Name	Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Max Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1026
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland.

Source Dataset Sampling Location
Location Name	Lake Cadagno, Switzerland
Coordinates	Lat. (^o)	46.5499	Long. (^o)	8.711	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071979	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138308_1958212	F071979	N/A	MDAWDMISPFVISEFVDLFALSSVEDRWGNRKLTGVNLLKNLGKLTLNHCRNWQRDSFNYASTEDFTSKEWAQSLMMTSCDVLLADRIDEKLFDELDLYEQE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.