Scaffold Ga0138308_157614

Overview

Basic Information

• Taxon OID: 3300010965
• Scaffold ID: Ga0138308_157614
• Source Dataset Name: Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Max Planck Institute for Marine Microbiology, Max Planck Institute for Plant Breeding Research
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1520
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline → Microbial Communities From Lake Cadagno Chemocline, Switzerland.

Source Dataset Sampling Location

• Location Name: Lake Cadagno, Switzerland
• Coordinates
  • Lat. (^o): 46.5499
  • Long. (^o): 8.711

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002643	Metagenome / Metatranscriptome	540	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138308_1576143	F002643	N/A	MKYQQLNTLVASINAVIGSQETKVQKKLFRLYEKVKSHHESYQAQVEELRLDNASTDDKDILLLDEKNGYKFTKESIKKLTTQVKELGEKEFDFTPIPVVNPQGLEDFTFLENWTSGIEFIKEEEEEL*