Scaffold Ga0139175_104879

Overview

Basic Information

• Taxon OID: 3300010946
• Scaffold ID: Ga0139175_104879
• Source Dataset Name: Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Autonomous University of Barcelona
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1836
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location

• Location Name: Alicante,Spain
• Coordinates
  • Lat. (^o): 38.34
  • Long. (^o): -0.48

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025488	Metagenome / Metatranscriptome	201	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0139175_1048793	F025488	N/A	GNSTATALYDIVKVSTSGSTADTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDYLNQTYRSASTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAAIAGTNTKWLVTFNVHQFKATA*