Basic Information | |
---|---|
Taxon OID | 3300010946 Open in IMG/M |
Scaffold ID | Ga0139175_103634 Open in IMG/M |
Source Dataset Name | Wastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Autonomous University of Barcelona |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2193 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Alicante,Spain | |||||||
Coordinates | Lat. (o) | 38.34 | Long. (o) | -0.48 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082719 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0139175_1036341 | F082719 | N/A | MARGSDFITLARQHNRAIWDGINALVALQREWQALDYGNTLEDGDGANADYTAAEVGAVVFDTANAFVTVLGAGHATNMAKLL* |
⦗Top⦘ |