NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139175_102258

Scaffold Ga0139175_102258


Overview

Basic Information
Taxon OID3300010946 Open in IMG/M
Scaffold IDGa0139175_102258 Open in IMG/M
Source Dataset NameWastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAutonomous University of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2906
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location
Location NameAlicante,Spain
CoordinatesLat. (o)38.34Long. (o)-0.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008183Metagenome / Metatranscriptome337Y

Sequences

Protein IDFamilyRBSSequence
Ga0139175_1022583F008183AGGAGVAFDDSDFDPVKYGVLWQKVQDMDKKVDKMERQLEQLLELANRSKGGLWFGMTIASAVSGIIGFVISHWKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.