NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139175_101845

Scaffold Ga0139175_101845


Overview

Basic Information
Taxon OID3300010946 Open in IMG/M
Scaffold IDGa0139175_101845 Open in IMG/M
Source Dataset NameWastewater viral communities and vesicles from water purifying plant in Alicante,Spain - replicate C1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAutonomous University of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3261
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → unclassified Chloroflexales → Chloroflexales bacterium ZM16-3(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater → Wastewater Viral Communities And Vesicles From Water Purifying Plant In Alicante,Spain

Source Dataset Sampling Location
Location NameAlicante,Spain
CoordinatesLat. (o)38.34Long. (o)-0.48Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F082719Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0139175_1018452F082719AGGAGMARGQDFITLARKHNKAIWDGINALVAMQREWNALDYGNTLPDGEGGNADYTADEIGAVVFDTANALVAVLAAGHATNMSRLL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.