Scaffold Ga0137776_1882249

Overview

Basic Information

• Taxon OID: 3300010937
• Scaffold ID: Ga0137776_1882249
• Source Dataset Name: Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Minnesota - Twin Cities
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 756
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Dco-Ecs Fumarole Sampling, Azores 2015

Source Dataset Sampling Location

• Location Name: Furnas, Sao Miguel
• Coordinates
  • Lat. (^o): 37.772747
  • Long. (^o): -25.304072

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012888	Metagenome / Metatranscriptome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137776_18822491	F012888	GGTGG	MKSLFVRIFLSFWIAQALFFVLAILVTLAFRPRSSTWEALRTSVLNDAVIAYEDGGKPQLREYLNNLDSSQHIRAYLFDEHGVELSERGAPDWAMRVAAGGPRTPHDGFLFPAPPVQRDSRASFDGKHRYTVVLGLPPGPRVFI