Scaffold Ga0137776_1836310

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137776_1836310

Scaffold Ga0137776_1836310

Overview

Basic Information
Taxon OID	3300010937 Open in IMG/M
Scaffold ID	Ga0137776_1836310 Open in IMG/M
Source Dataset Name	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Minnesota - Twin Cities
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	653
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Dco-Ecs Fumarole Sampling, Azores 2015

Source Dataset Sampling Location
Location Name	Furnas, Sao Miguel
Coordinates	Lat. (^o)	37.772747	Long. (^o)	-25.304072	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033563	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137776_18363101	F033563	AGGAG	MTNKSKHAGLGIALGAALGAVFGLLAGHMSVWLVIGIAIGTLIGASIRRKPTECPECAQVHRAHELRRQL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.