Basic Information | |
---|---|
Taxon OID | 3300010931 Open in IMG/M |
Scaffold ID | Ga0137937_1031372 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from North Pond, Atlantic Mid-Ocean Ridge - NP_U1383E_lower_OATZ |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 660 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment → Marine Sediment Microbial Communities From North Pond, Atlantic Mid-Ocean Ridge. |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Pond, Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 22.8 | Long. (o) | -46.05 | Alt. (m) | Depth (m) | 4425 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035626 | Metagenome / Metatranscriptome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137937_10313721 | F035626 | GAG | MLPIGSMAPSIIDNGAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTAGIRGDWIFDGFEPRPSAPHCHDGHDLALLLNSALEAAPASASTLNLETTAPIEDGRLDAASGAAIPTV |
⦗Top⦘ |