Scaffold Ga0136264_10096467

Overview

Basic Information

• Taxon OID: 3300010874
• Scaffold ID: Ga0136264_10096467
• Source Dataset Name: Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) (version 3)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 884
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: New Mexico, USA
• Coordinates
  • Lat. (^o): 35.8911
  • Long. (^o): -106.2978

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003205	Metagenome / Metatranscriptome	501	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136264_100964672	F003205	AGG	LTLEAALAQAPAPAPPERQQAPKETLTGCVMEAKTTDGGKAYVLNNAEGGSAKLYVLAASSPSELGTNATTKVDTNVNMKVEVTGPVQQPAAPADAAPADPKVLRPPTVQVESVKTVAETCGK*