Basic Information | |
---|---|
Taxon OID | 3300010870 Open in IMG/M |
Scaffold ID | Ga0102750_10298194 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines Pi 3A (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 631 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | New Mexico, USA | |||||||
Coordinates | Lat. (o) | 35.8911 | Long. (o) | -106.2978 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F008413 | Metagenome / Metatranscriptome | 333 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102750_102981942 | F008413 | N/A | ALALISMSLVSCMEDLNMFDKVGVASSDKSDAVMATAYSIAKTNTDQYFINNQKGYATPEYVAKLPPRKPLTGGKIVSIDELPSESDYYDGSRKLRITSTTCTQWTTLPELCMKQASCGWCASSKNCIPGNNLGPLAPCLAGKFFFSAPNSNFNLLSHDNYSMTRSAVGNAQLTTVIDNTK* |
⦗Top⦘ |