Scaffold Ga0118733_102498514

Overview

Basic Information

• Taxon OID: 3300010430
• Scaffold ID: Ga0118733_102498514
• Source Dataset Name: Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1022
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment → Marine Sediment Microbial Communities From The Atlantic Coast Under Amendment With Organic Carbon And Nitrate

Source Dataset Sampling Location

• Location Name: Atlantic Coast
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105204	Metagenome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0118733_1024985142	F105204	AGGAGG	MTRRKIGRTILIAGAVSCALLQFACQTEESPSAVTGGYTFSRDFEGARAVLRIEPSQEQPAECMLTDLPAGQSAPWKETTLDPAIHRALLDLLFDDARSPHYESDTAASVVAEKFVCSTRVGESEFCYVPQVVVTGMSSPWRFGLQAELTLSEQSQELIDEFLSAHEACWGGGTPMD*