Scaffold Ga0136852_10720821

Overview

Basic Information

• Taxon OID: 3300010412
• Scaffold ID: Ga0136852_10720821
• Source Dataset Name: Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Novogene Bioinformatics Technology Co., Ltd
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 956
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location

• Location Name: Mai Po Marshes at Hong Kong
• Coordinates
  • Lat. (^o): 22.0
  • Long. (^o): 114.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049002	Metagenome / Metatranscriptome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136852_107208212	F049002	GGAG	MAKTKLDKAQAELTRAIENDAPCTFEEPIPVQVTLDNGVKYEGLAIKVEPAGDVFPRGLVMVRAGNTDIGVPVNYIKAK*