Scaffold Ga0136852_10401500

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136852_10401500

Scaffold Ga0136852_10401500

Overview

Basic Information
Taxon OID	3300010412 Open in IMG/M
Scaffold ID	Ga0136852_10401500 Open in IMG/M
Source Dataset Name	Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Novogene Bioinformatics Technology Co., Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1338
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment → Mangrove Sediment Microbial Communities From Mai Po Nature Reserve Marshes In Hong Kong, China

Source Dataset Sampling Location
Location Name	Mai Po Marshes at Hong Kong
Coordinates	Lat. (^o)	22.0	Long. (^o)	114.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004285	Metagenome / Metatranscriptome	445	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136852_104015003	F004285	GGAG	MSLSWISNRSLKLSPRVRLVADGEAEALRRKLEGLEWRPQNGFLKDQFIEKTPPAGTRGSRAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.