Scaffold Ga0136993_10081622

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136993_10081622

Scaffold Ga0136993_10081622

Overview

Basic Information
Taxon OID	3300010411 Open in IMG/M
Scaffold ID	Ga0136993_10081622 Open in IMG/M
Source Dataset Name	Aquatic microbial communities from North Sea petroleum storage tank - Cell3b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	657
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location Name	North Sea
Coordinates	Lat. (^o)	60.9	Long. (^o)	1.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092080	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136993_100816222	F092080	AGGAGG	MQDKRITIRIPFEIWKGLRELQTMGKISSIQQAAVTGMDNLIQSLQADLGQNQREAATKRVLNILVEEKPFGSWEDVHRKRTDTDACRS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.