NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136992_10000089

Scaffold Ga0136992_10000089


Overview

Basic Information
Taxon OID3300010410 Open in IMG/M
Scaffold IDGa0136992_10000089 Open in IMG/M
Source Dataset NameAquatic microbial communities from North Sea petroleum storage tank - Cell4b
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterShell Corporation
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)33340
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)25 (80.65%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Aquatic → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location
Location NameNorth Sea
CoordinatesLat. (o)60.9Long. (o)1.8Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025288Metagenome / Metatranscriptome202N
F031475Metagenome / Metatranscriptome182N

Sequences

Protein IDFamilyRBSSequence
Ga0136992_1000008926F031475GGAMGANTSDSSQDSLNANPQKQREKLTQLDFLTLEMMGISLEELRALLDEEELQAYFAFLRRQSSDLDSTSP*
Ga0136992_1000008927F025288AGGAMKNIWIWITLTVIVIFGLIAGAGLLGYQVGLRSANALAPQIDEDRALPRQLMPWLRTAPDGGIIRRPTGFIGYFFLFPLGLLLRLAILVLVVWLVVKVAKAAWNSGNHKPQPAEAVITQTPEKTPEATVSAAPPEEAAPPSEATQGGEK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.