Scaffold Ga0136843_103354

Overview

Basic Information

• Taxon OID: 3300010407
• Scaffold ID: Ga0136843_103354
• Source Dataset Name: Microbial communities from soil contaminated with neutral mine drainage from mine ?rea in Canaa dos Carajas, Brazil - beginning channel, sample P3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Illumina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 505
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Microbial Communities From Soil Contaminated With Neutral Mine Drainage From Mine ??Rea In Canaa Dos Carajas, Brazil

Source Dataset Sampling Location

• Location Name: Canaa dos Carajas, PA, Brazil
• Coordinates
  • Lat. (^o): -6.42916667
  • Long. (^o): -50.06611111

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040563	Metagenome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136843_1033541	F040563	N/A	ERTLLVLNRRTQAGVETDQAARFFNRKPDLVVPFTPVFDESADRGRPLVVVRADNAAANVMRDLAAQITVLAPAGR*