Scaffold Ga0134121_10172762

Overview

Basic Information

• Taxon OID: 3300010401
• Scaffold ID: Ga0134121_10172762
• Source Dataset Name: Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1855
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil → Terrestrial Soil Microbial Communities With And Without Nitrogen Fertilizer From Kellogg Biological Station, Michigan, Usa

Source Dataset Sampling Location

• Location Name: USA: Kellog Biological Station, Michigan
• Coordinates
  • Lat. (^o): 42.3938
  • Long. (^o): -85.3708

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007671	Metagenome / Metatranscriptome	347	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134121_101727622	F007671	GAG	VDQPSTPGYSPDDLRRLSEILGGGFVEPEDIRRVLDEYGYLAEWKEHYAIQSVRSSLRNSRITCIDAAILSYGLLELLFRDIKRRLLAIHRRDQHGEEVGHCVTLYWGDDGRVGALSKSSFPGLGHRDAVFADEAAVASSYAQAYLAMGFEPLYFGVTTLEEVAGDLDWRCHEGDLNVLSERLKERYEYAFMLAR*