Scaffold Ga0116196_1067418

Overview

Basic Information

• Taxon OID: 3300010393
• Scaffold ID: Ga0116196_1067418
• Source Dataset Name: Hot spring sediment microbial communities from Zodletone spring, Oklahoma to study Microbial Dark Matter (Phase II) - Zodletone Spring source 0.5m metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: Oklahoma, Zodletone Spring
• Coordinates
  • Lat. (^o): 34.9956
  • Long. (^o): -98.6889

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054137	Metagenome	140	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116196_10674182	F054137	GGAGG	MMYVVRNRYKESLKPADFPKVNKLIDEGIIPAMEKVQGVRSVRAFNALSGEVILLVEIDELAAIDRALVDEEYGRIAAGMFDYMVRVGGEVWYDRRSWAKCYGRDTTTQERP*